Mycolicibacter heraklionensis: K3U94_08470 Help Entry K3U94_08470       CDS       T07612                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mher  Mycolicibacter heraklionensis Pathway mher00261   Monobactam biosynthesis mher01100   Metabolic pathways mher01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mher00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     K3U94_08470  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mher01008]     K3U94_08470 Polyketide biosynthesis proteins [BR:mher01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     K3U94_08470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QZA09259 UniProt:  A0A9X7ZGN1 LinkDB All DBs Position 1811247..1811477 Genome browser AA seq 76 aa AA seqDB search MSTNPFDDENGSFYVLINDEEQYSLWPTFANVPAGWRVVYGAEQGAARAACLEYVEQHWN DLRPKSLRDAMAAGEG NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatccctttgacgacgaaaacggcagcttctacgtgctgatcaacgacgag gagcagtacagcctctggccgacgttcgccaacgttcctgctgggtggcgagtggtctac ggagctgaacagggtgccgcccgggcggcatgtttggagtacgtcgagcagcactggaac gacctgcggcccaagagtcttcgtgatgccatggcggccggcgaaggctag

DBGET integrated database retrieval system