Mycolicibacter hiberniae: MHIB_09980 Help Entry MHIB_09980        CDS       T06801                                  Symbol mbtH Name (GenBank) protein MbtH   KO K05375   MbtH protein Organism mhib  Mycolicibacter hiberniae Pathway mhib00261   Monobactam biosynthesis mhib01100   Metabolic pathways mhib01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mhib00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MHIB_09980 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mhib01008]     MHIB_09980 (mbtH) Polyketide biosynthesis proteins [BR:mhib01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MHIB_09980 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBZ22580 UniProt:  A0A7I7WZY7 LinkDB All DBs Position 1075821..1076051 Genome browser AA seq 76 aa AA seqDB search MSTNPFDDESGSFYVLVNDEQQYSLWPVFADVPAGWQVVYGGEQGAARAACLDYVEQNWT DLRPKSLRDAMAAERG NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatccctttgacgacgagagcggcagcttctacgtgctggtcaacgacgag cagcagtacagtctgtggccggttttcgccgatgtgcccgcggggtggcaggtggtctac gggggtgagcagggcgcagcccgggcggcctgcctggactacgtcgaacagaactggacc gacctgcggcccaagagcctgcgcgacgccatggcggccgaacgggggtag

DBGET integrated database retrieval system