Mesorhizobium huakuii: MCHK_2474 Help Entry MCHK_2474         CDS       T06432                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mhua  Mesorhizobium huakuii Pathway mhua00790   Folate biosynthesis mhua01100   Metabolic pathways mhua01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:mhua00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     MCHK_2474 (folB) Enzymes [BR:mhua01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      MCHK_2474 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      MCHK_2474 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      MCHK_2474 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DinI Motif Other DBs NCBI-ProteinID:  AID30287 LinkDB All DBs Position 3977513..3977872 Genome browser AA seq 119 aa AA seqDB search MYVIRLKNCAFFARHGVLDEEEALGQRFYVDAMLSVEPGRALVDDAIEETVNYGIAFTVI EKIITGERRFLIEALAMEVAKALTERFPQIKRAEITVRKPNAPVPGVLDYVEVTVVWPE NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtatgtcatccgcctgaagaactgcgccttctttgcccggcatggcgtgctcgacgag gaggaggcgctcggccagcgtttctatgtcgacgcgatgctgtcggtcgaacccgggcgc gcgcttgtcgacgacgccatcgaggaaaccgtcaactacggcattgccttcacggtgatc gagaagatcatcaccggcgaacggcgtttcctgatcgaggccctggccatggaagtggca aaggcgctgacggagcggtttccgcagatcaaaagggccgaaatcaccgtgcgcaagccg aacgcgccggtgcctggcgtgctcgattatgtcgaggtgaccgttgtctggcccgagtaa

DBGET integrated database retrieval system