Micromonospora sp. B006: MicB006_5892 Help Entry MicB006_5892      CDS       T05583                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism micb  Micromonospora sp. B006 Pathway micb00261   Monobactam biosynthesis micb01100   Metabolic pathways micb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:micb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MicB006_5892  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:micb01008]     MicB006_5892 Polyketide biosynthesis proteins [BR:micb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MicB006_5892 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AXO38150 UniProt:  A0A385B1G9 LinkDB All DBs Position 6582961..6583149 Genome browser AA seq 62 aa AA seqDB search MAESRFLVVRNDEEQYSIWSADRELPAGWHGTGFAGSREECLAHVDEVWTDMRPRSVREA LS NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggccgaatcccgattccttgtcgtccgcaacgacgaggagcagtactcgatctggtcg gccgaccgcgagctgcccgccggctggcacggcaccggcttcgccggcagccgcgaggag tgcctggcccacgtggacgaggtctggaccgacatgcgtccccgctcggtgcgcgaggcc ctctcatga

DBGET integrated database retrieval system