Micromonospora sp. HM134: FJK98_20130 Help Entry FJK98_20130       CDS       T06145                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mich  Micromonospora sp. HM134 Pathway mich00261   Monobactam biosynthesis mich01100   Metabolic pathways mich01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mich00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FJK98_20130  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mich01008]     FJK98_20130 Polyketide biosynthesis proteins [BR:mich01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FJK98_20130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QDY09179 UniProt:  A0A518WIT3 LinkDB All DBs Position complement(4686667..4686855) Genome browser AA seq 62 aa AA seqDB search MADTRFLVVRNDEEQYSIWAADRDLPAGWHDAGFSGSREECLAHVDEVWTDMRPRSVREQ TA NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggccgacacccgattcctggtcgtgcgcaacgacgaggagcagtactcgatctgggcg gccgaccgcgacctgcccgccggctggcacgacgcgggcttctccggcagccgcgaggag tgcctggcccacgtggacgaggtctggaccgacatgcgtccgcgttcggtacgggagcag acggcatga

DBGET integrated database retrieval system