Microbulbifer sp. THAF38: FIU95_01915 Help Entry FIU95_01915       CDS       T06274                                  Symbol folB Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mict  Microbulbifer sp. THAF38 Pathway mict00790   Folate biosynthesis mict01100   Metabolic pathways mict01240   Biosynthesis of cofactors Module mict_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:mict00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     FIU95_01915 (folB) Enzymes [BR:mict01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      FIU95_01915 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      FIU95_01915 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      FIU95_01915 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QFT53337 UniProt:  A0A5P9ES33 LinkDB All DBs Position 445993..446382 Genome browser AA seq 129 aa AA seqDB search MDIVYIRDLKVDTIIGIYDWEREVRQTVSLDLEMAFDISEAARTDNIEYTLNYKAVAKRL IAFIESSEFLLVETMAEQAAAIVREEFSVSWLRLRLSKPGAVRGSRDVGVIIERGERPAI GAAAMSAGV NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggatattgtttatatacgggatttaaaggtggataccattattggtatctacgattgg gagcgggaagtacgccagactgttagccttgatctggaaatggctttcgatatcagtgaa gcggcacgcacagacaatattgagtacacactgaactataaagcggtggccaagcgcctg atcgcttttattgagagcagcgaattcctgttggtggaaaccatggcggaacaggctgcg gcaattgtcagggaagagttttccgtaagctggctgcgactgcgtttgtccaagccaggc gcggtcagagggtccagggatgtgggtgtcattatcgagcgcggcgagaggccggcaata ggtgcagcagcgatgtctgcgggagtataa

DBGET integrated database retrieval system