Mycolicibacterium insubricum: MINS_33100 Help Entry MINS_33100        CDS       T06933                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism mij  Mycolicibacterium insubricum Pathway mij00261   Monobactam biosynthesis mij01100   Metabolic pathways mij01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mij00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MINS_33100  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mij01008]     MINS_33100 Polyketide biosynthesis proteins [BR:mij01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MINS_33100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBZ67881 UniProt:  A0A1X0DPM2 LinkDB All DBs Position complement(3474788..3475000) Genome browser AA seq 70 aa AA seqDB search MSTNPFDDENGTFYVLVNDEEQHSLWPSFAEVPAGWTIAVGPAPRTDCLAYVEANWADIR PRSLREALAN NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatccgttcgatgacgagaacggcaccttctacgtcctggtcaacgacgag gagcagcacagcctgtggccgtcgttcgccgaggtccccgcgggctggacgatcgccgtc ggcccggcgccccgcaccgactgcctggcctacgtcgaggcgaactgggccgatatccgc ccgcgcagcctgcgtgaggcgctggcgaactag

DBGET integrated database retrieval system