Mycobacterium paraintracellulare: OCQ_27520 Help Entry OCQ_27520         CDS       T01755                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism mir  Mycobacterium paraintracellulare Pathway mir00261   Monobactam biosynthesis mir01100   Metabolic pathways mir01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mir00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     OCQ_27520  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mir01008]     OCQ_27520 Polyketide biosynthesis proteins [BR:mir01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     OCQ_27520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFC54264 UniProt:  A0A7I7TTX0 LinkDB All DBs Position complement(2929213..2929434) Genome browser AA seq 73 aa AA seqDB search MQLNPFDDDGGSFFVLVNNEEQHSLWPTFTTVPAGWRVVFGQADRAACLHYIEEHWPDIR AKSLRDTPTRAGL NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgcagctcaatccgttcgacgacgacggcggcagttttttcgtcctggtcaataacgaa gaacaacacagtctttggccaacttttactaccgttcccgccggttggagagtagttttt gggcaagccgaccgcgccgcatgcctgcactacatcgaagaacactggcccgatatccgg gcgaaaagcctccgcgacacgccgacccgcgccggtttgtga

DBGET integrated database retrieval system