Mitsuaria sp. 7: ABE85_18095 Help Entry ABE85_18095       CDS       T04402                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism miu  Mitsuaria sp. 7 Pathway miu00790   Folate biosynthesis miu01100   Metabolic pathways miu01240   Biosynthesis of cofactors Module miu_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:miu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ABE85_18095 Enzymes [BR:miu01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      ABE85_18095  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      ABE85_18095  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      ABE85_18095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF4929 Motif Other DBs NCBI-ProteinID:  ANH70686 UniProt:  A0A1A9HRV2 LinkDB All DBs Position 4124581..4124949 Genome browser AA seq 122 aa AA seqDB search MRRNNRQVIHINGLRFGANLGVLDFERQGPQPILVDAEINLGAQTIVSRDADIGHVLDYR RVRTIIIDECTAEHTDLLEALLGKLCVRLMKLPGVVGVRIKVTKLEIFPDCQVAISAECG QW NT seq 369 nt NT seq  +upstreamnt  +downstreamnt ctgcgccgcaacaaccgccaggtcatccacatcaacgggctgcgcttcggcgccaacctc ggcgtgctcgacttcgagcgccaggggccgcagcccatcctggtcgacgccgagatcaac ctcggcgcgcagaccatcgtctcgcgcgacgccgacatcggccacgtgctggactaccgc cgcgtgcgcaccatcatcatcgacgagtgcaccgcggaacacaccgacctgctcgaagcc ctgctgggcaagctctgcgtccggctgatgaagctgcccggtgtggtgggcgtgcgcatc aaggtgaccaagctcgaaatcttccccgactgccaagtcgcaatcagcgccgaatgtggc cagtggtga

DBGET integrated database retrieval system