Mycobacteroides immunogenum: BAB75_12040 Help Entry BAB75_12040       CDS       T04755                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism miz  Mycobacteroides immunogenum Pathway miz00261   Monobactam biosynthesis miz01100   Metabolic pathways miz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:miz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BAB75_12040  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:miz01008]     BAB75_12040 Polyketide biosynthesis proteins [BR:miz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BAB75_12040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANO04011 UniProt:  A0A7V8LKN1 LinkDB All DBs Position 2445781..2445996 Genome browser AA seq 71 aa AA seqDB search MSINPFDDESGEFYVLVNDEEQHSLWPKAIEVPEQWRVVFGAAPRADCVEYVEANWSDMR PKSLRDAMAGN NT seq 216 nt NT seq  +upstreamnt  +downstreamnt ttgagtatcaacccatttgatgacgagagcggcgagttctacgtgctggtcaacgatgag gagcagcacagtctgtggcccaaggctattgaggttccggagcagtggcgggtggtcttc ggcgcggcaccacgcgcggactgcgtggagtatgtagaggccaactggtcggacatgcgc ccgaagagcctgcgcgacgcgatggcgggcaactag

DBGET integrated database retrieval system