Mesobacillus jeotgali: FOF60_05495 Help Entry FOF60_05495       CDS       T08547                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mjo  Mesobacillus jeotgali Pathway mjo00020   Citrate cycle (TCA cycle) mjo01100   Metabolic pathways mjo01110   Biosynthesis of secondary metabolites mjo01120   Microbial metabolism in diverse environments mjo01200   Carbon metabolism mjo01210   2-Oxocarboxylic acid metabolism Module mjo_M00009   Citrate cycle (TCA cycle, Krebs cycle) mjo_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:mjo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     FOF60_05495 Enzymes [BR:mjo01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      FOF60_05495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_2 Fer4_21 Fer4_6 Fer4_16 Fer4_9 Fer4_4 Fer4_13 Fer4_15 Fer4_8 Fer4_3 Fer4_18 Fer4_17 Fer4_22 DJ-1_PfpI Motif Other DBs NCBI-ProteinID:  UYZ23010 LinkDB All DBs Position 1101766..1101996 Genome browser AA seq 76 aa AA seqDB search MEQKVVFNEETCKSCKLCVNVCPTNVIYLADYLNEKGYRPAIVTDQENCISCGKCAQMCP DSVITVYRPEKVRKSV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtggagcagaaagttgtttttaacgaggagacttgcaagtcatgcaagctgtgcgtgaat gtttgtccgacaaatgtgatttatcttgctgattacttgaatgaaaaaggctaccggccg gcgattgtgacagaccaggaaaattgcatcagctgcggcaagtgcgcgcaaatgtgtccg gattcggtaatcactgtctataggccagaaaaggtaaggaaatctgtttag

DBGET integrated database retrieval system