Methanopyrus kandleri: MK0727 Help Entry MK0727            CDS       T00078                                  Name (GenBank) Ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mka  Methanopyrus kandleri Pathway mka00020   Citrate cycle (TCA cycle) mka00720   Carbon fixation pathways in prokaryotes mka01100   Metabolic pathways mka01110   Biosynthesis of secondary metabolites mka01120   Microbial metabolism in diverse environments mka01200   Carbon metabolism mka01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:mka00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     MK0727   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     MK0727 Enzymes [BR:mka01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      MK0727 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4_7 Fer4 Fer4_9 Fer4_2 Fer4_6 Fer4_16 Fer4_3 Fer4_10 Fer4_8 Fer4_4 Fer4_13 Fer4_18 Motif Other DBs NCBI-ProteinID:  AAM01941 UniProt:  Q8TXE7 LinkDB All DBs Position 694590..694850 Genome browser AA seq 86 aa AA seqDB search MGGSGGEEGGRGAGKTSYEVVIREEHCKGCFLCSWVCPIDALKRSNRRNERGYLLPEWNG ECTGCRQCELICPDLAIEVREVEGDG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgggaggatccggtggtgaggaaggcgggagaggagctggcaagacgtcttacgaggta gtaatccgcgaggagcactgcaagggatgcttcctctgctcctgggtctgcccgatcgac gcgctgaagaggtcgaaccggaggaacgagcgcggttacctgctcccggaatggaacggc gagtgcaccggatgtcgacagtgcgagctcatttgccccgacctcgcgatcgaggtgagg gaggtggagggagatgggtaa

DBGET integrated database retrieval system