Mandrillus leucophaeus (drill): 105545146 Help Entry 105545146         CDS       T08763                                  Symbol PRKCB Name (RefSeq) protein kinase C beta type   KO K19662   classical protein kinase C beta type [EC:2.7.11.13] Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu01521   EGFR tyrosine kinase inhibitor resistance mleu04010   MAPK signaling pathway mleu04012   ErbB signaling pathway mleu04014   Ras signaling pathway mleu04015   Rap1 signaling pathway mleu04020   Calcium signaling pathway mleu04062   Chemokine signaling pathway mleu04064   NF-kappa B signaling pathway mleu04066   HIF-1 signaling pathway mleu04070   Phosphatidylinositol signaling system mleu04071   Sphingolipid signaling pathway mleu04150   mTOR signaling pathway mleu04270   Vascular smooth muscle contraction mleu04310   Wnt signaling pathway mleu04370   VEGF signaling pathway mleu04510   Focal adhesion mleu04540   Gap junction mleu04613   Neutrophil extracellular trap formation mleu04650   Natural killer cell mediated cytotoxicity mleu04662   B cell receptor signaling pathway mleu04666   Fc gamma R-mediated phagocytosis mleu04670   Leukocyte transendothelial migration mleu04713   Circadian entrainment mleu04720   Long-term potentiation mleu04723   Retrograde endocannabinoid signaling mleu04724   Glutamatergic synapse mleu04725   Cholinergic synapse mleu04726   Serotonergic synapse mleu04727   GABAergic synapse mleu04728   Dopaminergic synapse mleu04730   Long-term depression mleu04750   Inflammatory mediator regulation of TRP channels mleu04911   Insulin secretion mleu04912   GnRH signaling pathway mleu04916   Melanogenesis mleu04918   Thyroid hormone synthesis mleu04919   Thyroid hormone signaling pathway mleu04921   Oxytocin signaling pathway mleu04925   Aldosterone synthesis and secretion mleu04928   Parathyroid hormone synthesis, secretion and action mleu04929   GnRH secretion mleu04931   Insulin resistance mleu04933   AGE-RAGE signaling pathway in diabetic complications mleu04935   Growth hormone synthesis, secretion and action mleu04960   Aldosterone-regulated sodium reabsorption mleu04961   Endocrine and other factor-regulated calcium reabsorption mleu04970   Salivary secretion mleu04971   Gastric acid secretion mleu04972   Pancreatic secretion mleu04973   Carbohydrate digestion and absorption mleu05017   Spinocerebellar ataxia mleu05022   Pathways of neurodegeneration - multiple diseases mleu05031   Amphetamine addiction mleu05032   Morphine addiction mleu05140   Leishmaniasis mleu05143   African trypanosomiasis mleu05146   Amoebiasis mleu05161   Hepatitis B mleu05163   Human cytomegalovirus infection mleu05164   Influenza A mleu05170   Human immunodeficiency virus 1 infection mleu05171   Coronavirus disease - COVID-19 mleu05200   Pathways in cancer mleu05205   Proteoglycans in cancer mleu05206   MicroRNAs in cancer mleu05207   Chemical carcinogenesis - receptor activation mleu05214   Glioma mleu05223   Non-small cell lung cancer mleu05225   Hepatocellular carcinoma mleu05231   Choline metabolism in cancer mleu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105545146 (PRKCB)    04012 ErbB signaling pathway     105545146 (PRKCB)    04014 Ras signaling pathway     105545146 (PRKCB)    04015 Rap1 signaling pathway     105545146 (PRKCB)    04310 Wnt signaling pathway     105545146 (PRKCB)    04370 VEGF signaling pathway     105545146 (PRKCB)    04064 NF-kappa B signaling pathway     105545146 (PRKCB)    04066 HIF-1 signaling pathway     105545146 (PRKCB)    04020 Calcium signaling pathway     105545146 (PRKCB)    04070 Phosphatidylinositol signaling system     105545146 (PRKCB)    04071 Sphingolipid signaling pathway     105545146 (PRKCB)    04150 mTOR signaling pathway     105545146 (PRKCB)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     105545146 (PRKCB)    04540 Gap junction     105545146 (PRKCB)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105545146 (PRKCB)    04650 Natural killer cell mediated cytotoxicity     105545146 (PRKCB)    04662 B cell receptor signaling pathway     105545146 (PRKCB)    04666 Fc gamma R-mediated phagocytosis     105545146 (PRKCB)    04670 Leukocyte transendothelial migration     105545146 (PRKCB)    04062 Chemokine signaling pathway     105545146 (PRKCB)   09152 Endocrine system    04911 Insulin secretion     105545146 (PRKCB)    04929 GnRH secretion     105545146 (PRKCB)    04912 GnRH signaling pathway     105545146 (PRKCB)    04921 Oxytocin signaling pathway     105545146 (PRKCB)    04935 Growth hormone synthesis, secretion and action     105545146 (PRKCB)    04918 Thyroid hormone synthesis     105545146 (PRKCB)    04919 Thyroid hormone signaling pathway     105545146 (PRKCB)    04928 Parathyroid hormone synthesis, secretion and action     105545146 (PRKCB)    04916 Melanogenesis     105545146 (PRKCB)    04925 Aldosterone synthesis and secretion     105545146 (PRKCB)   09153 Circulatory system    04270 Vascular smooth muscle contraction     105545146 (PRKCB)   09154 Digestive system    04970 Salivary secretion     105545146 (PRKCB)    04971 Gastric acid secretion     105545146 (PRKCB)    04972 Pancreatic secretion     105545146 (PRKCB)    04973 Carbohydrate digestion and absorption     105545146 (PRKCB)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     105545146 (PRKCB)    04961 Endocrine and other factor-regulated calcium reabsorption     105545146 (PRKCB)   09156 Nervous system    04724 Glutamatergic synapse     105545146 (PRKCB)    04727 GABAergic synapse     105545146 (PRKCB)    04725 Cholinergic synapse     105545146 (PRKCB)    04728 Dopaminergic synapse     105545146 (PRKCB)    04726 Serotonergic synapse     105545146 (PRKCB)    04720 Long-term potentiation     105545146 (PRKCB)    04730 Long-term depression     105545146 (PRKCB)    04723 Retrograde endocannabinoid signaling     105545146 (PRKCB)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     105545146 (PRKCB)   09159 Environmental adaptation    04713 Circadian entrainment     105545146 (PRKCB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105545146 (PRKCB)    05206 MicroRNAs in cancer     105545146 (PRKCB)    05205 Proteoglycans in cancer     105545146 (PRKCB)    05207 Chemical carcinogenesis - receptor activation     105545146 (PRKCB)    05231 Choline metabolism in cancer     105545146 (PRKCB)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     105545146 (PRKCB)    05214 Glioma     105545146 (PRKCB)    05223 Non-small cell lung cancer     105545146 (PRKCB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105545146 (PRKCB)    05161 Hepatitis B     105545146 (PRKCB)    05171 Coronavirus disease - COVID-19     105545146 (PRKCB)    05164 Influenza A     105545146 (PRKCB)    05163 Human cytomegalovirus infection     105545146 (PRKCB)   09174 Infectious disease: parasitic    05146 Amoebiasis     105545146 (PRKCB)    05140 Leishmaniasis     105545146 (PRKCB)    05143 African trypanosomiasis     105545146 (PRKCB)   09164 Neurodegenerative disease    05017 Spinocerebellar ataxia     105545146 (PRKCB)    05022 Pathways of neurodegeneration - multiple diseases     105545146 (PRKCB)   09165 Substance dependence    05031 Amphetamine addiction     105545146 (PRKCB)    05032 Morphine addiction     105545146 (PRKCB)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     105545146 (PRKCB)   09167 Endocrine and metabolic disease    04931 Insulin resistance     105545146 (PRKCB)    04933 AGE-RAGE signaling pathway in diabetic complications     105545146 (PRKCB)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     105545146 (PRKCB)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mleu01001]     105545146 (PRKCB) Enzymes [BR:mleu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.13  protein kinase C      105545146 (PRKCB) Protein kinases [BR:mleu01001]  Serine/threonine kinases: AGC group   PKC family [OT]    105545146 (PRKCB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr C2 Pkinase_C C1_1 Kinase-like Haspin_kinase ABC1 CEP76-C2 Motif Other DBs NCBI-GeneID:  105545146 NCBI-ProteinID:  XP_011843331 Ensembl:  ENSMLEG00000036377 LinkDB All DBs Position Unknown AA seq 542 aa AA seqDB search MKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPN GLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDL TSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEGNEELRQKFERAK ISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYA VKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLM YHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCK ENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDEL FQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLE RKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVI NV NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt atgaaatgtgacacctgcatgatgaacgtgcacaagcgctgcgtgatgaatgtccccagc ctctgtggcacggaccacacggagcgccgcggccgcatctacatccaggcccacatcgac agggatgttctcatcgtcctcgtaagagatgctaaaaaccttgtacctatggaccccaat ggcctgtcagatccctacgtaaaactgaaactgattcctgatcccaaaagtgagagcaaa cagaagaccaaaaccatcaaatgctccctcaaccctgagtggaacgagacatttagattt cagctgaaagaatcggacaaagacagaagactgtcagtagagatttgggattgggatttg accagcaggaatgacttcatgggatctttgtcctttgggatttctgaacttcagaaagcc agtgttgatggctggtttaagttactgagccaggaggaaggcgagtacttcaatgtgcct gtgccaccagaaggaagtgagggcaatgaagaactgcggcagaaattcgagagggccaag atcagtcagggaaccaaagtcccggaagaaaagacgaccaatactgtctccaaatttgac aacaatggcaacagagaccggatgaaactgactgattttaacttcctaatggtgctgggg aaaggcagctttggcaaggtcatgctttcagaacgaaaaggcacagatgagctctatgct gtgaagatcctgaagaaggatgtcgtgatccaagatgatgacgtggagtgcactatggtg gagaagcgggtgctggctctacccgggaagccgcccttcctgacccagctccactcctgc ttccagaccatggaccgcctgtactttgtgatggagtacgtcaacgggggcgacctcatg tatcacatccagcaagttggccggttcaaggagccccatgccgtattttacgctgcagaa attgccatcggtctgttcttcttacagagtaagggcatcatttaccgtgacctaaaactt gacaacgtgatgctcgattctgaggggcacatcaagattgctgattttggcatgtgtaag gagaacatctgggatggggtgacaaccaagacattctgtggcactccagactacatcgcc cctgagataattgcttatcagccctatgggaagtccgtggattggtgggcatttggagtc ctgctgtatgaaatgttggctgggcaggcaccctttgaaggggaggatgaagatgaactc ttccagtccatcatggaacacaacgtagcctatcccaagtctatgtccaaggaagctgtg gccatctgcaaagggctgatgaccaaacacccgggcaaacgtttgggttgtggacctgaa ggcgaacgtgatatcaaagagcatgcatttttccggtatattgattgggagaaacttgaa cgcaaagagatccagcccccatataagccaaaagctagagacaagagagacacctccaac ttcgacaaagagttcaccagacagcctgtggaactgacccccactgacaaactcttcatc atgaacttggaccaaaatgaatttgctggcttctcttacactaacccagagtttgtcatt aatgtgtag

DBGET integrated database retrieval system