Mandrillus leucophaeus (drill): 105550000 Help Entry 105550000         CDS       T08763                                  Name (RefSeq) ferritin heavy chain   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu00860   Porphyrin metabolism mleu04216   Ferroptosis mleu04217   Necroptosis mleu04978   Mineral absorption Brite KEGG Orthology (KO) [BR:mleu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     105550000  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     105550000    04217 Necroptosis     105550000  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     105550000  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mleu04147]     105550000 Enzymes [BR:mleu01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      105550000 Exosome [BR:mleu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    105550000   Exosomal proteins of bladder cancer cells    105550000 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  105550000 NCBI-ProteinID:  XP_011850165 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search EKLMKLQNQRGGRIFLQDIKKPDYDDWESGLNATECALHLEKNVDQSLLERHKLATDKND PQLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLADYLFDKHTLGDSDNES NT seq 351 nt NT seq  +upstreamnt  +downstreamnt gagaaactgatgaagctgcagaaccaacgaggtggccgaatcttccttcaggatatcaag aaaccagactatgacgactgggagagcgggctgaatgcaacggagtgtgctttacatttg gaaaaaaatgtggatcagtcactactggaacggcacaaactggccactgacaaaaatgac ccccagttgtgtgacttcattgagacacattacctgaatgaacaggtgaaagccatcaaa gaattgggtgaccacgtgaccaacttgcgcaagatgggagcacccgaatctggcttggca gattatctgttcgacaagcacaccctgggagacagtgataatgaaagctaa

DBGET integrated database retrieval system