Mycolicibacterium litorale: B1R94_01765 Help Entry B1R94_01765       CDS       T05032                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mll  Mycolicibacterium litorale Pathway mll00261   Monobactam biosynthesis mll01100   Metabolic pathways mll01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mll00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B1R94_01765  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mll01008]     B1R94_01765 Polyketide biosynthesis proteins [BR:mll01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B1R94_01765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AQT78232 LinkDB All DBs Position complement(400791..401036) Genome browser AA seq 81 aa AA seqDB search MSSNPFDDPDGRFFVLVNDEDQHSLWPTFSAVPSGWTIAFGGPDGADRDSALRYVDENWT DMRPRSLREQMSRADGAAASA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt ttgtccagcaatccttttgacgatccagacggccgcttcttcgtcctggtcaacgacgag gaccagcactcgctgtggcccaccttctccgccgttccctcggggtggaccatcgctttc ggtgggccggacggcgccgaccgggacagcgcgctgcgatacgtcgacgagaactggacc gacatgcgccccaggtcgctgcgcgaacagatgagccgggccgacggcgcggccgcatcg gcttga

DBGET integrated database retrieval system