Mycolicibacterium litorale: B1R94_25130 Help Entry B1R94_25130       CDS       T05032                                  Name (GenBank) toluene monooxygenase   KO K15761   toluene monooxygenase system protein B [EC:1.14.13.236 1.14.13.-] Organism mll  Mycolicibacterium litorale Pathway mll00623   Toluene degradation mll01100   Metabolic pathways mll01120   Microbial metabolism in diverse environments mll01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:mll00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00623 Toluene degradation     B1R94_25130 Enzymes [BR:mll01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.236  toluene 4-monooxygenase      B1R94_25130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TmoB Motif Other DBs NCBI-ProteinID:  AQT81831 LinkDB All DBs Position 5273740..5273997 Genome browser AA seq 85 aa AA seqDB search MALMPVQGQVLGDFVINLVPIDSDDTMDVVAEKIAHHSINRRVAQQDRPLRVRHHGHVLA VDATPASAGVNPLDYLEAFYSDGAQ NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcattgatgccggttcagggccaggttctcggtgacttcgtcatcaacctggtgccg atcgacagcgacgacacgatggacgtggtggccgagaagatcgcccaccactcgatcaac cgccgagtcgcccagcaggacaggcctttacgggtgcgccaccacggtcatgtgctggcg gtggacgcgacaccggcaagcgccggcgtgaacccactcgattacctcgaggcgttctac tcggacggtgcccagtga

DBGET integrated database retrieval system