Mycobacterium lepraemurium: MLM_2677 Help Entry MLM_2677          CDS       T05534                                  Name (GenBank) protein MbtH   KO K05375   MbtH protein Organism mlp  Mycobacterium lepraemurium Pathway mlp00261   Monobactam biosynthesis mlp01100   Metabolic pathways mlp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mlp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MLM_2677  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mlp01008]     MLM_2677 Polyketide biosynthesis proteins [BR:mlp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MLM_2677 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ATA28915 LinkDB All DBs Position complement(2677808..2677993) Genome browser AA seq 61 aa AA seqDB search MTFVVLVDVEDQHSLWPTFAETPPGWRVVFGAAGRTDCLQYVEQNWSDIRPKSLIEVLAG E NT seq 186 nt NT seq  +upstreamnt  +downstreamnt gtgaccttcgtggtgctggtcgacgtcgaggaccagcacagcctgtggccgaccttcgcc gagacgcccccgggctggcgcgtggtcttcggtgcggccggccgcaccgactgcctgcag tacgtggagcagaattggtcggatatccggcccaagagcctgatcgaggtgctcgccggc gagtag

DBGET integrated database retrieval system