Melampsora larici-populina: MELLADRAFT_87167 Help Entry MELLADRAFT_87167  CDS       T03138                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism mlr  Melampsora larici-populina Pathway mlr03020   RNA polymerase mlr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mlr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     MELLADRAFT_87167   09124 Replication and repair    03420 Nucleotide excision repair     MELLADRAFT_87167  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mlr03021]     MELLADRAFT_87167    03400 DNA repair and recombination proteins [BR:mlr03400]     MELLADRAFT_87167 Transcription machinery [BR:mlr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      MELLADRAFT_87167   RNA polymerase III system    RNA polymerase III      MELLADRAFT_87167   RNA polymerase I system    RNA polymerase I      MELLADRAFT_87167 DNA repair and recombination proteins [BR:mlr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       MELLADRAFT_87167 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Motif Other DBs NCBI-GeneID:  18934413 NCBI-ProteinID:  XP_007403890 JGI:  Mellp1_87167 UniProt:  F4R4R7 LinkDB All DBs Position Unknown AA seq 72 aa AA seqDB search MIIPVRCFTCGKVVGNVWDQYLQILQSGVSEGDAMDALGLKRYCCRRMVLTHVDLIEKLL QYNPYEKRSDRA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgattattccagtcagatgttttacatgtggcaaagtggtaggaaacgtatgggatcaa taccttcaaatcttacaaagtggagtttcagaaggtgacgcgatggacgctttaggtttg aagagatattgttgtcgtcgaatggttttgactcatgtggatcttattgaaaaattacta caatacaatccttatgagaaacggtctgatagggcttaa

DBGET integrated database retrieval system