Micrococcus lylae: CJ228_009950 Help Entry CJ228_009950      CDS       T09111                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mly  Micrococcus lylae Pathway mly00790   Folate biosynthesis mly01100   Metabolic pathways mly01240   Biosynthesis of cofactors Module mly_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:mly00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CJ228_009950 (folB) Enzymes [BR:mly01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CJ228_009950 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CJ228_009950 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CJ228_009950 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB ADK Motif Other DBs NCBI-ProteinID:  WIK83411 LinkDB All DBs Position 2253727..2254098 Genome browser AA seq 123 aa AA seqDB search MRLMGISAVGHHGVFEEEKREGQPFAVDVVMHVDVAEAAATDDLTKTVNYAEVGDLVAGF IMGEPFDLIETLADRIVGTILQTQPLVETVEVTVHKPQAPLPHEFHDVQVTVVRDRADLE ASR NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atccgcctcatgggcatctccgccgtcggccaccacggcgtcttcgaggaggagaagcgc gagggacagccgttcgccgtggacgtggtcatgcacgtggacgtcgccgaggccgccgcc acggacgacctgacgaagaccgtgaactacgccgaggtcggggacctggtggccgggttc atcatgggcgagcccttcgacctcatcgagacgctggcggaccgcatcgtcggcacgatc ctgcagacccagccgctggtggagaccgtggaggtcaccgtgcacaagccgcaggccccg ctgccgcacgagttccacgacgtccaggtgacggtcgtccgcgaccgcgccgacctcgag gcctcccgctga

DBGET integrated database retrieval system