Mycobacterium malmoense: K3U93_15745 Help Entry K3U93_15745       CDS       T07571                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mmam  Mycobacterium malmoense Pathway mmam00261   Monobactam biosynthesis mmam01100   Metabolic pathways mmam01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mmam00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     K3U93_15745  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mmam01008]     K3U93_15745 Polyketide biosynthesis proteins [BR:mmam01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     K3U93_15745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QZA16153 LinkDB All DBs Position complement(3391140..3391355) Genome browser AA seq 71 aa AA seqDB search MSTNPFDDDGGAFFVLVNDEEQHSLWPSFAEVPPGWRVVYGAAGRAECLDYVEKNWTDLR PKSLREAMGAD NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatcccttcgatgacgacggcggggcgttcttcgtgctggtcaacgacgag gagcagcacagcctgtggccttccttcgccgaggtcccgcccggctggcgggtggtgtac ggcgcggcgggccgggcggagtgcctcgactacgtcgaaaagaactggaccgacctgcgg cccaagagcctgcgtgaggccatgggggcggactga

DBGET integrated database retrieval system