Mycobacterium mantenii: MMAN_20560 Help Entry MMAN_20560        CDS       T07431                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism mman  Mycobacterium mantenii Pathway mman00261   Monobactam biosynthesis mman01100   Metabolic pathways mman01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mman00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MMAN_20560  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mman01008]     MMAN_20560 Polyketide biosynthesis proteins [BR:mman01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MMAN_20560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBY37922 LinkDB All DBs Position complement(2236885..2237100) Genome browser AA seq 71 aa AA seqDB search MSANPFDDDNASFVVLVNDEEQHSLWPTFADTPAGWRVAFGEASRADCLQYVEQNWSDIR PKSLIEALAVQ NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcgccaacccctttgacgacgacaacgcgagctttgtggtgctggtcaacgacgag gagcagcacagcctctggccgaccttcgctgacacgccggccggctggcgggtggcgttc ggcgaagccagccgcgcggactgcctgcagtacgtggagcagaactggtcggacatccgg cccaagagcctgatcgaggcgcttgccgtccagtga

DBGET integrated database retrieval system