Marinomonas mediterranea: Marme_1355 Help Entry Marme_1355        CDS       T01449                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism mme  Marinomonas mediterranea Pathway mme00261   Monobactam biosynthesis mme01100   Metabolic pathways mme01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mme00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Marme_1355  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mme01008]     Marme_1355 Polyketide biosynthesis proteins [BR:mme01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Marme_1355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADZ90628 UniProt:  F2JWF5 LinkDB All DBs Position 1516392..1516601 Genome browser AA seq 69 aa AA seqDB search MSDTSTNPFDNESLTFSVLVNDLNQHSLWPEFAVIPLGWESVFGPASHAECLVFIDQHWT DIRPVSRTA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcgacacatctacaaacccttttgacaatgaatcactaacgttttccgttttggtc aatgacttaaatcagcacagtttatggcctgaatttgcggttattccattgggttgggaa tctgtcttcggacccgcttctcatgctgaatgcctcgtatttattgaccaacattggacg gatattcgcccagtttcgcggactgcttaa

DBGET integrated database retrieval system