Mus musculus (house mouse): 16000 Help Entry 16000             CDS       T01002                                  Symbol Igf1, C730016P09Rik, Igf-1, Igf-I Name (RefSeq) insulin-like growth factor 1   KO K05459   insulin-like growth factor 1 Organism mmu  Mus musculus (house mouse) Pathway mmu01521   EGFR tyrosine kinase inhibitor resistance mmu01522   Endocrine resistance mmu04010   MAPK signaling pathway mmu04014   Ras signaling pathway mmu04015   Rap1 signaling pathway mmu04066   HIF-1 signaling pathway mmu04068   FoxO signaling pathway mmu04114   Oocyte meiosis mmu04115   p53 signaling pathway mmu04150   mTOR signaling pathway mmu04151   PI3K-Akt signaling pathway mmu04152   AMPK signaling pathway mmu04211   Longevity regulating pathway mmu04213   Longevity regulating pathway - multiple species mmu04510   Focal adhesion mmu04550   Signaling pathways regulating pluripotency of stem cells mmu04730   Long-term depression mmu04750   Inflammatory mediator regulation of TRP channels mmu04913   Ovarian steroidogenesis mmu04914   Progesterone-mediated oocyte maturation mmu04935   Growth hormone synthesis, secretion and action mmu04960   Aldosterone-regulated sodium reabsorption mmu05200   Pathways in cancer mmu05202   Transcriptional misregulation in cancer mmu05205   Proteoglycans in cancer mmu05214   Glioma mmu05215   Prostate cancer mmu05218   Melanoma mmu05224   Breast cancer mmu05410   Hypertrophic cardiomyopathy mmu05414   Dilated cardiomyopathy Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     16000 (Igf1)    04014 Ras signaling pathway     16000 (Igf1)    04015 Rap1 signaling pathway     16000 (Igf1)    04066 HIF-1 signaling pathway     16000 (Igf1)    04068 FoxO signaling pathway     16000 (Igf1)    04151 PI3K-Akt signaling pathway     16000 (Igf1)    04152 AMPK signaling pathway     16000 (Igf1)    04150 mTOR signaling pathway     16000 (Igf1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     16000 (Igf1)    04115 p53 signaling pathway     16000 (Igf1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     16000 (Igf1)    04550 Signaling pathways regulating pluripotency of stem cells     16000 (Igf1)  09150 Organismal Systems   09152 Endocrine system    04913 Ovarian steroidogenesis     16000 (Igf1)    04914 Progesterone-mediated oocyte maturation     16000 (Igf1)    04935 Growth hormone synthesis, secretion and action     16000 (Igf1)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     16000 (Igf1)   09156 Nervous system    04730 Long-term depression     16000 (Igf1)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     16000 (Igf1)   09149 Aging    04211 Longevity regulating pathway     16000 (Igf1)    04213 Longevity regulating pathway - multiple species     16000 (Igf1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     16000 (Igf1)    05202 Transcriptional misregulation in cancer     16000 (Igf1)    05205 Proteoglycans in cancer     16000 (Igf1)   09162 Cancer: specific types    05214 Glioma     16000 (Igf1)    05218 Melanoma     16000 (Igf1)    05215 Prostate cancer     16000 (Igf1)    05224 Breast cancer     16000 (Igf1)   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     16000 (Igf1)    05414 Dilated cardiomyopathy     16000 (Igf1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     16000 (Igf1)    01522 Endocrine resistance     16000 (Igf1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmu04052]     16000 (Igf1) Cytokines and neuropeptides [BR:mmu04052]  Cytokines   Growth factors (RTK binding)    16000 (Igf1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  16000 NCBI-ProteinID:  NP_001104745 MGI:  96432 Ensembl:  ENSMUSG00000020053 UniProt:  P05017 Q4VJC0 LinkDB All DBs Position 10:87694127..87772909 Genome browser AA seq 153 aa AA seqDB search MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSTTAGPETLCGAELVD ALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAARS IRAQRHTDMPKTQKEVHLKNTSRGSAGNKTYRM NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggggaaaatcagcagccttccaactcaattatttaagatctgcctctgtgacttcttg aagataaagatacacatcatgtcgtcttcacacctcttctacctggcgctctgcttgctc accttcaccagctccaccacagctggaccagagaccctttgcggggctgagctggtggat gctcttcagttcgtgtgtggaccgaggggcttttacttcaacaagcccacaggctatggc tccagcattcggagggcacctcagacaggcattgtggatgagtgttgcttccggagctgt gatctgaggagactggagatgtactgtgccccactgaagcctacaaaagcagcccgctct atccgtgcccagcgccacactgacatgcccaagactcagaaggaagtacatttgaagaac acaagtagaggaagtgcaggaaacaagacctacagaatgtag

DBGET integrated database retrieval system