Mus musculus (house mouse): 17720 Help Entry 17720             CDS       T01002                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism mmu  Mus musculus (house mouse) Pathway mmu00190   Oxidative phosphorylation mmu01100   Metabolic pathways mmu04714   Thermogenesis mmu04723   Retrograde endocannabinoid signaling mmu05010   Alzheimer disease mmu05012   Parkinson disease mmu05014   Amyotrophic lateral sclerosis mmu05016   Huntington disease mmu05020   Prion disease mmu05022   Pathways of neurodegeneration - multiple diseases mmu05208   Chemical carcinogenesis - reactive oxygen species mmu05415   Diabetic cardiomyopathy Module mmu_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:mmu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     17720 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     17720 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     17720 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     17720 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     17720 (ND4L)    05012 Parkinson disease     17720 (ND4L)    05014 Amyotrophic lateral sclerosis     17720 (ND4L)    05016 Huntington disease     17720 (ND4L)    05020 Prion disease     17720 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     17720 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     17720 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:mmu03029]     17720 (ND4L) Enzymes [BR:mmu01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      17720 (ND4L) Mitochondrial biogenesis [BR:mmu03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     17720 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 DUF5368 Hpre_diP_synt_I Motif Other DBs NCBI-GeneID:  17720 NCBI-ProteinID:  NP_904336 MGI:  102497 UniProt:  P03903 Q9MD77 Structure PDB LinkDB All DBs Position MT:9877..10173 Genome browser AA seq 98 aa AA seqDB search MPSTFFNLTMAFSLSLLGTLMFRSHLMSTLLCLEGMVLSLFIMTSVTSLNSNSMSSMPIP ITILVFAACEAAVGLALLVKVSNTYGTDYVQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgccatctaccttcttcaacctcaccatagccttctcactatcacttctagggacactt atatttcgctctcacctaatatccacattactatgcctggaaggcatagtattatcctta tttattataacttcagtaacttccctaaactccaactccataagctccataccaatcccc atcaccatcttagttttcgcagcctgcgaagcagctgtaggactagccctactagtaaaa gtttcaaacacgtacggaacagattacgtccaaaatctcaacctactacaatgctaa

DBGET integrated database retrieval system