Mycolicibacterium mucogenicum: C1S78_008530 Help Entry C1S78_008530      CDS       T07324                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mmuc  Mycolicibacterium mucogenicum Pathway mmuc00261   Monobactam biosynthesis mmuc01100   Metabolic pathways mmuc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mmuc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C1S78_008530  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mmuc01008]     C1S78_008530 Polyketide biosynthesis proteins [BR:mmuc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C1S78_008530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QPG70971 UniProt:  A0A8H2JAX4 LinkDB All DBs Position 1758720..1758932 Genome browser AA seq 70 aa AA seqDB search MSSNPFDDENGSFYVLINDEEQHSLWPVFVDVPAGWRVVFGESTRADCLAYVEETWTDIR PKTLRDSLVG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcagcaatccgttcgatgacgagaacggttcgttctacgtcctgatcaacgacgaa gagcagcacagcctgtggccggtgttcgtcgacgtgcccgccggctggcgggtggtgttc ggtgagagcacgcgcgccgactgcctggcctacgtcgaagagacctggaccgacatccgg cccaagactttgcgcgattctctggtcggctga

DBGET integrated database retrieval system