Marinomonas sp. MWYL1: Mmwyl1_1046 Help Entry Mmwyl1_1046       CDS       T00567                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mmw  Marinomonas sp. MWYL1 Pathway mmw00790   Folate biosynthesis mmw01100   Metabolic pathways mmw01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:mmw00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Mmwyl1_1046 Enzymes [BR:mmw01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Mmwyl1_1046  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Mmwyl1_1046  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Mmwyl1_1046 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ABR69977 UniProt:  A6VU48 LinkDB All DBs Position 1165793..1166158 Genome browser AA seq 121 aa AA seqDB search MKDLVFIEGLKTQAVIGVYEWEKKIQQDLVFDLEMEHDNRVPAETDDLAKTLDYEAISNY ILAFCAERQFELIETLAEHLVGELIGKFKLNAVTLTLRKPGAVPTAQAVGVKIHRKSAVT Y NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgaaagacttagtgtttattgagggactaaaaactcaagccgtgattggtgtgtatgag tgggaaaaaaagattcagcaagatttagtgtttgatttggaaatggagcatgataatcgt gttccagcagagactgacgatctggctaagacgttagattacgaagctatctcgaattat attttggcattttgcgccgagcgtcagtttgagttaattgaaactttggcggagcatttg gtgggagagctgattggaaaatttaagttgaacgctgtcacgttaactttgcgtaagcct ggcgctgttccgactgctcaagccgttggtgtgaaaattcacagaaaatctgctgtaact tattga

DBGET integrated database retrieval system