Merops nubicus (carmine bee-eater): 103774539 Help Entry 103774539         CDS       T08417                                  Name (RefSeq) ferritin heavy chain   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb00860   Porphyrin metabolism mnb04216   Ferroptosis mnb04217   Necroptosis Brite KEGG Orthology (KO) [BR:mnb00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     103774539  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     103774539    04217 Necroptosis     103774539  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mnb04147]     103774539 Enzymes [BR:mnb01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      103774539 Exosome [BR:mnb04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103774539   Exosomal proteins of bladder cancer cells    103774539 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Rubrerythrin FCH Motif Other DBs NCBI-GeneID:  103774539 NCBI-ProteinID:  XP_008940199 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search LFQSYYFDRDDVALKNFAKYFLHQSHEEREHAQKLMKLQNQRGGRIFLQDIKKPDRDDWE NGLTAMECALHLEKNVNQSLLELHKLATEKNDPHLCDFIETHYLDEQVKAIKELGDHVTN LRKMGAPKYGMAEYLFDKHTLGDSSQS NT seq 444 nt NT seq  +upstreamnt  +downstreamnt ctctttcagtcctactactttgaccgggatgatgtggctctgaaaaactttgccaagtac ttcctgcatcagtcccacgaggaacgtgagcatgcccagaagctgatgaaactacagaac cagaggggtggacgcatcttcttgcaggacatcaagaagcccgaccgtgatgactgggag aacgggctgactgccatggagtgtgccctgcacctggagaagaacgtcaaccagtccctg ctggagctgcacaagctggccactgagaagaacgacccccacttgtgcgacttcatcgag actcactacctggatgagcaggtcaaggccatcaaagagctgggtgaccacgtcaccaac ctgaggaagatgggagcccccaaatatggcatggcagagtacctctttgacaagcacacc ctcggggacagcagccagagctga

DBGET integrated database retrieval system