Mogibacterium neglectum: QU661_02260 Help Entry QU661_02260       CDS       T09253                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mnl  Mogibacterium neglectum Pathway mnl00020   Citrate cycle (TCA cycle) mnl01100   Metabolic pathways mnl01110   Biosynthesis of secondary metabolites mnl01120   Microbial metabolism in diverse environments mnl01200   Carbon metabolism mnl01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:mnl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     QU661_02260 Enzymes [BR:mnl01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      QU661_02260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_2 Fer4_21 Fer4_10 Fer4_9 Fer4_6 Fer4_4 Fer4_8 Fer4_16 Fer4_3 Fer4_17 Fer4_18 Fer4_15 Fer4_13 Fer4_22 Motif Other DBs NCBI-ProteinID:  WLD76685 LinkDB All DBs Position 496749..496961 Genome browser AA seq 70 aa AA seqDB search MAKGRVEINAEACKSCQYCVISCPKKVLVIGENVNSKGYPYSVAATPEDCIGCAMCAQIC PEDCIEVWRD NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggctaaaggtagagttgaaatcaatgctgaagcttgcaaatcttgccaatattgcgtg atttcatgtccaaagaaagtcctcgttattggtgagaatgttaactcaaaaggttaccct tattcggttgcagctacaccagaggattgcatcggttgcgcaatgtgcgcacagatatgt ccagaggactgtattgaggtttggagagattag

DBGET integrated database retrieval system