Mycobacterium novum: MNVM_03460 Help Entry MNVM_03460        CDS       T06926                                  Symbol mbtH Name (GenBank) protein MbtH   KO K05375   MbtH protein Organism mnm  Mycobacterium novum Pathway mnm00261   Monobactam biosynthesis mnm01100   Metabolic pathways mnm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mnm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MNVM_03460 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mnm01008]     MNVM_03460 (mbtH) Polyketide biosynthesis proteins [BR:mnm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MNVM_03460 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBX11265 UniProt:  A0A7I7JH78 LinkDB All DBs Position complement(354278..354508) Genome browser AA seq 76 aa AA seqDB search MSTNPFDDDNGSFYVLINDEDQYSLWPSFADVPAGWRVVYGGEQGAARAACLEYVEQRWT DLRPKSLRDAMAAERG NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaacccctttgacgacgacaacggtagtttttacgtgctgatcaacgatgag gaccagtacagcctctggcccagtttcgccgacgttcccgccgggtggcgggtggtctac ggcggcgagcagggcgcggcccgcgcggcctgtctggagtatgtcgaacaacgttggact gacctgcggccgaagagccttcgtgatgccatggcggccgaacgggggtaa

DBGET integrated database retrieval system