Massilia sp. NR 4-1: ACZ75_17315 Help Entry ACZ75_17315       CDS       T04026                                  Name (GenBank) diguanylate cyclase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mnr  Massilia sp. NR 4-1 Pathway mnr00790   Folate biosynthesis mnr01100   Metabolic pathways mnr01240   Biosynthesis of cofactors Module mnr_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:mnr00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ACZ75_17315 Enzymes [BR:mnr01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      ACZ75_17315  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      ACZ75_17315  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      ACZ75_17315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF3734 Motif Other DBs NCBI-ProteinID:  AKU22951 UniProt:  A0A0K1K154 LinkDB All DBs Position 4160096..4160494 Genome browser AA seq 132 aa AA seqDB search MLSALTHPRLQDCRRLFLRNYEVQINIGVHDFEKKGEQRVLINVDLYIPLSLSTPQADEL HEVVDYDFMRETIARRMAQGHVHLQETLCDDVLKAMLAHPRVRAVRVSTMKPDVYPDCEG VGVEVFRVKDEA NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgctgtccgccctcacccatccccgcctgcaagactgccgccggctgttcctgcgcaat tacgaagtgcagatcaatatcggcgtgcacgatttcgagaagaagggcgaacagcgcgtc ctgatcaatgtggacctgtatattccactgtccctgtcgacgccgcaggcggacgagctg catgaagtggtcgactacgacttcatgcgcgaaacgatcgcgcgccgcatggcccagggc catgtgcatctgcaggaaaccctgtgcgacgacgtgctgaaagccatgctggcgcacccg cgcgtgcgtgccgtgcgcgtctcgaccatgaagcccgacgtctaccccgattgcgaaggc gtgggcgtggaagtcttccgtgtgaaggacgaagcatga

DBGET integrated database retrieval system