Mycobacterium ostraviense: LTS72_04090 Help Entry LTS72_04090       CDS       T07946                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mot  Mycobacterium ostraviense Pathway mot00261   Monobactam biosynthesis mot01100   Metabolic pathways mot01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mot00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LTS72_04090  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mot01008]     LTS72_04090 Polyketide biosynthesis proteins [BR:mot01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LTS72_04090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UGT92584 LinkDB All DBs Position complement(832757..832981) Genome browser AA seq 74 aa AA seqDB search MSTNPFDDETGSFCVLVNDDEQHSLWPAFAEIPAGWRKVYGEASRADCLQYVEEHWTDMR PKSLREAVNSQQSR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatcccttcgatgacgagaccggctccttttgcgtgctggtcaacgacgat gagcagcacagcctgtggcccgcgttcgccgagatcccggccggctggcgcaaggtgtac ggcgaagccagccgggcggattgcctgcaatacgtcgaggaacactggaccgacatgcgg ccgaagagcctgcgcgaagcagtgaattcgcagcagtctcgttag

DBGET integrated database retrieval system