Methanogenium organophilum: OU421_02940 Help Entry OU421_02940       CDS       T08653                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mou  Methanogenium organophilum Pathway mou00020   Citrate cycle (TCA cycle) mou00720   Carbon fixation pathways in prokaryotes mou01100   Metabolic pathways mou01110   Biosynthesis of secondary metabolites mou01120   Microbial metabolism in diverse environments mou01200   Carbon metabolism mou01210   2-Oxocarboxylic acid metabolism Module mou_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mou00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     OU421_02940   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     OU421_02940 Enzymes [BR:mou01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      OU421_02940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_10 Fer4_21 Fer4_9 Fer4_4 Fer4_16 Fer4_8 Fer4_3 Fer4_15 Fer4_11 Fer4_13 Fer4_22 Motif Other DBs NCBI-ProteinID:  WAI01845 UniProt:  A0A9X9S5I5 LinkDB All DBs Position 566674..566946 Genome browser AA seq 90 aa AA seqDB search MKLIIDERRCKGCNLCTTVCPYNIFQEGRKLNERGIIVPILDRPERCTNCRLRKLYGRQL CGACQMICPDQAIYWVEEDPYSEESVVIEF NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaactgataatcgatgaacggaggtgcaaagggtgcaacctctgcaccaccgtctgc ccatacaatatatttcaggaaggcagaaaactcaacgaacggggaattattgttcccatc cttgaccgcccggaacggtgcaccaactgccgcctcagaaaactctatgggaggcagtta tgcggcgcatgccagatgatctgcccggatcaggcaatttactgggttgaagaagaccct tattctgaagaaagcgtggtgattgagttttga

DBGET integrated database retrieval system