Methylogaea oryzae: MoryE10_17550 Help Entry MoryE10_17550     CDS       T07433                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism moz  Methylogaea oryzae Pathway moz00261   Monobactam biosynthesis moz01100   Metabolic pathways moz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:moz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MoryE10_17550  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:moz01008]     MoryE10_17550 Polyketide biosynthesis proteins [BR:moz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MoryE10_17550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Glyco_hydro_72 Motif Other DBs NCBI-ProteinID:  BBL71149 UniProt:  A0A8D4VRB5 LinkDB All DBs Position complement(2001796..2002014) Genome browser AA seq 72 aa AA seqDB search MSWENDDDATVYQVVINHEEQYSIWPEYKEIPLGWTALDKAGSKQECLDYIKAAWTDIRP LSLRRQMAEDAS NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgtcctgggaaaacgatgacgacgccacggtttaccaagtggtgatcaatcatgaggaa caatattcgatttggccggaatacaaggagatacccttgggctggacggctttggacaag gccggcagcaagcaggagtgcctcgactacatcaaggcggcgtggaccgatatacgtccg ctcagcctgcgccggcaaatggccgaagacgcgagttga

DBGET integrated database retrieval system