Mycobacterium paraterrae: MKK62_08950 Help Entry MKK62_08950       CDS       T08203                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mpaa  Mycobacterium paraterrae Pathway mpaa00261   Monobactam biosynthesis mpaa01100   Metabolic pathways mpaa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mpaa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MKK62_08950  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mpaa01008]     MKK62_08950 Polyketide biosynthesis proteins [BR:mpaa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MKK62_08950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UMB71353 LinkDB All DBs Position complement(5341280..5341492) Genome browser AA seq 70 aa AA seqDB search MSTNPFDDENGTFVVLVNDEDQHSLWPTFADIPAGWRKVFGEAGRAECLAYVEENWTDMR PRSLREAMDT NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatccattcgatgacgagaacgggacgttcgtcgtcctggtcaacgacgaa gaccagcacagcctgtggccgaccttcgccgacatcccggcgggttggcgcaaggtcttc ggcgaggccggccgcgcggaatgcctagcctatgtggaggagaactggaccgacatgcgg ccacgaagtctccgcgaggcgatggacacctga

DBGET integrated database retrieval system