Mycobacterium paragordonae: C0J29_00775 Help Entry C0J29_00775       CDS       T06847                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mpag  Mycobacterium paragordonae Pathway mpag00261   Monobactam biosynthesis mpag01100   Metabolic pathways mpag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mpag00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C0J29_00775  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mpag01008]     C0J29_00775 Polyketide biosynthesis proteins [BR:mpag01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C0J29_00775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AYE93561 UniProt:  A0A386TZP6 LinkDB All DBs Position 166922..167146 Genome browser AA seq 74 aa AA seqDB search MSTNPFDDETATFIVVVNDEEQHSLWPTFADVPAGWRRVFGEASRAECLQFVDEHWTDMR PRSLREAMNSQVTS NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatcccttcgatgacgagaccgccaccttcatcgtggtcgtcaatgacgaa gagcagcacagtttgtggcccaccttcgccgacgtcccggcaggctggcggcgggtattc ggtgaggcgagccgggcggaatgcctgcaattcgtcgacgagcactggaccgacatgcgg ccgaggagccttcgggaggcgatgaactcgcaggtcacgtcgtga

DBGET integrated database retrieval system