Mesotoga prima: Theba_1378 Help Entry Theba_1378        CDS       T02123                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mpg  Mesotoga prima Pathway mpg00020   Citrate cycle (TCA cycle) mpg01100   Metabolic pathways mpg01110   Biosynthesis of secondary metabolites mpg01120   Microbial metabolism in diverse environments mpg01200   Carbon metabolism mpg01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:mpg00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Theba_1378 Enzymes [BR:mpg01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Theba_1378 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_6 Fer4_21 Fer4_10 Fer4_9 Fer4_4 Fer4_16 Fer4_8 Fer4_15 Fer4_13 Fer4_22 Fer4_3 Fer4_17 Fer4_18 Motif Other DBs NCBI-ProteinID:  AFK07066 UniProt:  I2F563 LinkDB All DBs Position 1456553..1456777 Genome browser AA seq 74 aa AA seqDB search MSKNFVKIDEERCKGCGLCINFCPKKVLSFSDKFNSKGYRPAQLHDLENCIGCGFCYMMC PDAAITVFKETAEV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagcaaaaacttcgtgaagattgacgaagagcgttgcaaaggctgcggcctatgcatc aacttctgcccgaagaaagtactgagcttttcggacaaattcaacagcaaaggatatcgt cctgctcagctgcatgatctcgaaaactgtatcggatgcggattctgttatatgatgtgt ccagatgcagcaataaccgtcttcaaagaaacggccgaggtatag

DBGET integrated database retrieval system