Mycolicibacterium phocaicum: MPHO_19720 Help Entry MPHO_19720        CDS       T07283                                  Symbol mbtH Name (GenBank) protein MbtH   KO K05375   MbtH protein Organism mphu  Mycolicibacterium phocaicum Pathway mphu00261   Monobactam biosynthesis mphu01100   Metabolic pathways mphu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mphu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MPHO_19720 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mphu01008]     MPHO_19720 (mbtH) Polyketide biosynthesis proteins [BR:mphu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MPHO_19720 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH MC_hydratase Motif Other DBs NCBI-ProteinID:  BBZ54980 UniProt:  A0A7I7ZLN1 LinkDB All DBs Position complement(2003786..2003998) Genome browser AA seq 70 aa AA seqDB search MSSNPFDDENGAFYVLINDEEQHSLWPVFADVPAGWRVVFGESTRADCLAYVEETWTDIR PKTLRDTLVG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcagcaatccgttcgatgacgagaacggcgcgttctacgtcctgatcaacgacgaa gagcagcacagcctgtggccggtgttcgccgacgtgcccgccggttggcgggtcgtgttc ggtgagagcacgcgcgccgactgcctggcctacgtcgaggagacctggaccgacatccgg cccaagacgctgcgggacaccttggtgggctga

DBGET integrated database retrieval system