Mycolicibacterium poriferae: MPOR_40290 Help Entry MPOR_40290        CDS       T07158                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism mpof  Mycolicibacterium poriferae Pathway mpof00261   Monobactam biosynthesis mpof01100   Metabolic pathways mpof01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mpof00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MPOR_40290  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mpof01008]     MPOR_40290 Polyketide biosynthesis proteins [BR:mpof01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MPOR_40290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF359 Motif Other DBs NCBI-ProteinID:  BBX53003 UniProt:  A0A6N4VFU5 LinkDB All DBs Position complement(4209981..4210193) Genome browser AA seq 70 aa AA seqDB search MSTNPFDDDNGTFYVLVNDEEQYSLWPTFVAVPAGWRVVYGESNRADCLAWVEENWLDMR PRGLRESMSS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaacccgttcgatgacgacaacggcacgttctacgtgctggtcaacgacgaa gagcagtacagcttgtggccgacgttcgtcgccgttcccgcgggctggcgcgtcgtctac ggcgaaagcaatcgcgcagactgcctggcctgggtggaggagaactggctcgacatgcgt ccgcgcggcctgcgggagtcgatgtcgagctag

DBGET integrated database retrieval system