Moniliophthora perniciosa: MPER_09004 Help Entry MPER_09004        CDS       T01089                                  Name (GenBank) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism mpr  Moniliophthora perniciosa Pathway mpr03020   RNA polymerase mpr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mpr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     MPER_09004   09124 Replication and repair    03420 Nucleotide excision repair     MPER_09004  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mpr03021]     MPER_09004    03400 DNA repair and recombination proteins [BR:mpr03400]     MPER_09004 Transcription machinery [BR:mpr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      MPER_09004   RNA polymerase III system    RNA polymerase III      MPER_09004   RNA polymerase I system    RNA polymerase I      MPER_09004 DNA repair and recombination proteins [BR:mpr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       MPER_09004 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  EEB92478 UniProt:  E2LQ23 LinkDB All DBs AA seq 169 aa AA seqDB search MSDDGYGGGGGGDDFGDYNDMGYADEQFIDEGYDLLARDAEGQQGGEGVEQAGDPQINGV NGVDHDQEMANGEEPQEPPAQASILGERQPNKERITTPYLTKYERARILGTRALQISMNA PVLVPLDGETDALQIAIKELSQRKIPLIIRRYLPDGSFEDWSVSELITD NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atgtctgacgatggctatggtggaggtgggggaggtgatgactttggtgactataatgat atgggttatgccgatgaacaattcattgacgaaggttacgatcttctcgcgcgggatgcc gaagggcagcagggcggagaaggcgttgaacaggcaggggaccctcagataaatggtgtc aatggtgtagaccatgatcaggagatggcaaatggcgaggagcctcaagagccaccagcg caagcaagtatactgggagaacgacaaccgaataaagaacgaatcacaacaccatatctc acaaaatacgaacgtgctcgaattttaggaacaagagcgttgcagataagtatgaacgcc ccagtacttgtaccactcgacggcgaaaccgatgcactccaaatcgcgataaaagagttg tctcaacgaaaaattcctctcatcattcgacgttaccttcctgacggcagttttgaggat tggagtgtgtcagaactgattacggactag

DBGET integrated database retrieval system