Moniliophthora perniciosa: MPER_14021 Help Entry MPER_14021        CDS       T01089                                  Name (GenBank) hypothetical protein   KO K17069   O-acetylhomoserine/O-acetylserine sulfhydrylase [EC:2.5.1.49 2.5.1.47] Organism mpr  Moniliophthora perniciosa Pathway mpr00270   Cysteine and methionine metabolism mpr00920   Sulfur metabolism mpr01100   Metabolic pathways mpr01110   Biosynthesis of secondary metabolites mpr01200   Carbon metabolism mpr01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:mpr00001]  09100 Metabolism   09102 Energy metabolism    00920 Sulfur metabolism     MPER_14021   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     MPER_14021 Enzymes [BR:mpr01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.47  cysteine synthase      MPER_14021     2.5.1.49  O-acetylhomoserine aminocarboxypropyltransferase      MPER_14021 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cys_Met_Meta_PP Met_gamma_lyase Aminotran_5 SepSecS Motif Other DBs NCBI-ProteinID:  EEB88249 UniProt:  E2M252 LinkDB All DBs AA seq 105 aa AA seqDB search MFLICPRLAKIAHDNGIPLIVDNTFGIAGYLIRPIEYGADIVVHSATKWIGGHGTTIGGV IVDAGKFNWKNGKFPTFTEPSEGYHGLKFAETFGNLAFAVKVRTE NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgttcttgatctgcccgcgtttggcaaagattgcccatgacaacggcattcctctcatc gttgataataccttcggcatagcaggatacctcatccgaccaatcgagtacggtgccgac atcgtcgttcacagtgcaaccaagtggattggaggacatggaaccaccatcggcggagta attgtcgacgccggcaaattcaactggaagaacggcaagttccccacattcaccgagcca tcagaaggataccacggactcaagtttgctgaaacctttggtaaccttgcgttcgctgtc aaagtccgaacagag

DBGET integrated database retrieval system