Marinomonas primoryensis: MP3633_2428 Help Entry MP3633_2428       CDS       T06705                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mpri  Marinomonas primoryensis Pathway mpri00261   Monobactam biosynthesis mpri01100   Metabolic pathways mpri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mpri00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MP3633_2428  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mpri01008]     MP3633_2428 Polyketide biosynthesis proteins [BR:mpri01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MP3633_2428 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF3256 Motif Other DBs NCBI-ProteinID:  QKK81155 UniProt:  A0A859CWU3 LinkDB All DBs Position KMM3633:complement(2589342..2589566) Genome browser AA seq 74 aa AA seqDB search MSNETSNPFDNESLKFIVLVNALQQHSLWPIFKTTPQGWQPVFGPTTRDDCLDYVETNWT DIRPQGLPSLSNGS NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagtaatgaaacaagtaatccatttgataatgagtcactgaaatttattgttttggtg aacgcgctgcagcagcacagtttatggccgatttttaagacgacgccacaaggttggcag cccgtttttgggccgactacccgtgacgattgtctcgattatgttgaaacgaattggacg gatattcgtccacaaggcctaccttcactttctaacggttcctaa

DBGET integrated database retrieval system