Micromonospora profundi: Q3V37_15170 Help Entry Q3V37_15170       CDS       T09358                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mprn  Micromonospora profundi Pathway mprn00261   Monobactam biosynthesis mprn01100   Metabolic pathways mprn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mprn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Q3V37_15170  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mprn01008]     Q3V37_15170 Polyketide biosynthesis proteins [BR:mprn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Q3V37_15170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WLS48454 LinkDB All DBs Position complement(3309593..3309805) Genome browser AA seq 70 aa AA seqDB search MNPFDDPDGTFLVLVNDEDQHSLWLATLAVPAGWRVAHGPDGRQACLDYVEANWTDIRPR SARRDTATTS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgaaccccttcgatgaccccgacggcacattcctcgtgctcgtcaacgatgaggatcag cactcgctctggctggcgacgcttgccgttccggccggttggcgcgtcgcgcacggcccg gacggtcgtcaggcctgcctcgattacgtcgaggcgaactggaccgacatccgtccgcgc agcgcccgccgcgacacagccaccacgagctga

DBGET integrated database retrieval system