Methylovulum psychrotolerans: CEK71_15845 Help Entry CEK71_15845       CDS       T04929                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mpsy  Methylovulum psychrotolerans Pathway mpsy00261   Monobactam biosynthesis mpsy01100   Metabolic pathways mpsy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mpsy00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CEK71_15845  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mpsy01008]     CEK71_15845 Polyketide biosynthesis proteins [BR:mpsy01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CEK71_15845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ASF47413 UniProt:  A0A1Z4C1L0 LinkDB All DBs Position complement(3488888..3489109) Genome browser AA seq 73 aa AA seqDB search MALGDEEDNTVYQVVVNHEEQYSIWPDYKEIPGGWSAVNKSGNKQACLDYIKTVWTDMRP LSLRKQMEEAAQS NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggcgttaggtgacgaagaagataatacggtttatcaggttgtggtgaaccacgaagag caatactctatttggccggattataaggaaatccccggcggttggtctgccgttaataaa agcggcaacaaacaagcctgcttggattacataaaaacagtgtggacggatatgcgcccg ttaagtttgcgcaaacagatggaagaggccgcgcagtcttag

DBGET integrated database retrieval system