Myroides profundi: MPR_0012 Help Entry MPR_0012          CDS       T03631                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mpw  Myroides profundi Pathway mpw00790   Folate biosynthesis mpw01100   Metabolic pathways mpw01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:mpw00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     MPR_0012 Enzymes [BR:mpw01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      MPR_0012  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      MPR_0012  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      MPR_0012 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB RII_binding_1 Motif Other DBs NCBI-ProteinID:  AJH13231 UniProt:  A0A0B5RJU3 LinkDB All DBs Position complement(9230..9535) Genome browser AA seq 101 aa AA seqDB search MDEEAKIGSDYRVDLIAKGDFTMAASTDDLKHSIDYVHLNTIVKEEMAIRSKLLEHVAQR IIDRVILEIRMVEEITVLVSKINPPVGGDVEYVTVEMQGVR NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggatgaagaggcaaaaataggttcggattaccgagtagatttaatagcgaaaggagat tttacgatggctgcttctacagatgatctgaaacattctatagattacgttcacttaaat acaatcgtgaaggaagaaatggctattcgatctaagttattagagcatgtagcacaacga atcatcgatagagtaatcctagaaataagaatggtagaagaaataacagtattagtctct aaaataaaccctcctgtaggtggtgatgtagaatatgtaactgttgaaatgcaaggagtt agataa

DBGET integrated database retrieval system