Marinomonas rhizomae: KDW99_13015 Help Entry KDW99_13015       CDS       T08610                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mrhi  Marinomonas rhizomae Pathway mrhi00261   Monobactam biosynthesis mrhi01100   Metabolic pathways mrhi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mrhi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KDW99_13015  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mrhi01008]     KDW99_13015 Polyketide biosynthesis proteins [BR:mrhi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KDW99_13015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UTV98188 LinkDB All DBs Position complement(2752572..2752796) Genome browser AA seq 74 aa AA seqDB search MSNEAINPFDDDSLAFLVLVNALQQHSLWPLFKTMPAGWQQAFGPSSRDNCLEYIETNWT DIRPQNSPSLSSGS NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagtaatgaagcaattaacccatttgacgatgattcattggcgtttttggtcttagta aatgcactgcagcagcatagtttatggccgctttttaagactatgccagcaggttggcaa caggcttttgggccgagctctcgtgataattgtcttgaatatatcgaaacgaactggacg gatattcgcccacaaaattccccttcactttctagcggttcttaa

DBGET integrated database retrieval system