Methylocystis rosea: EHO51_17300 Help Entry EHO51_17300       CDS       T05721                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mros  Methylocystis rosea Pathway mros00261   Monobactam biosynthesis mros01100   Metabolic pathways mros01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mros00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     EHO51_17300  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mros01008]     EHO51_17300 Polyketide biosynthesis proteins [BR:mros01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     EHO51_17300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AZG78346 UniProt:  A0A3G8M8U8 LinkDB All DBs Position 3534436..3534660 Genome browser AA seq 74 aa AA seqDB search MNDAQPNPFDDESLTFLVLVNSQGQHSLWPTFAPEPAGWRRLFGPSDRSDCVKFVDEHWT DMRPKSLREASRPR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt gtgaacgacgcgcagccaaatccattcgacgacgaaagccttacgtttctcgttctggtc aactcccagggacaacacagtctctggccgacatttgccccggagcctgcaggttggcga cggctcttcggtccgagcgatcggagcgactgcgtaaaatttgtcgatgagcactggacg gacatgcgcccgaagtctcttcgtgaggcttctcgtccgcgctaa

DBGET integrated database retrieval system