Mauremys reevesii (Reeves's turtle): 120407327 Help Entry 120407327         CDS       T07797                                  Symbol KRAS Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism mrv  Mauremys reevesii (Reeves's turtle) Pathway mrv04010   MAPK signaling pathway mrv04012   ErbB signaling pathway mrv04068   FoxO signaling pathway mrv04137   Mitophagy - animal mrv04140   Autophagy - animal mrv04150   mTOR signaling pathway mrv04210   Apoptosis mrv04218   Cellular senescence mrv04370   VEGF signaling pathway mrv04371   Apelin signaling pathway mrv04540   Gap junction mrv04625   C-type lectin receptor signaling pathway mrv04810   Regulation of actin cytoskeleton mrv04910   Insulin signaling pathway mrv04912   GnRH signaling pathway mrv04914   Progesterone-mediated oocyte maturation mrv04916   Melanogenesis Brite KEGG Orthology (KO) [BR:mrv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120407327 (KRAS)    04012 ErbB signaling pathway     120407327 (KRAS)    04370 VEGF signaling pathway     120407327 (KRAS)    04371 Apelin signaling pathway     120407327 (KRAS)    04068 FoxO signaling pathway     120407327 (KRAS)    04150 mTOR signaling pathway     120407327 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120407327 (KRAS)    04137 Mitophagy - animal     120407327 (KRAS)   09143 Cell growth and death    04210 Apoptosis     120407327 (KRAS)    04218 Cellular senescence     120407327 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     120407327 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120407327 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120407327 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     120407327 (KRAS)    04912 GnRH signaling pathway     120407327 (KRAS)    04914 Progesterone-mediated oocyte maturation     120407327 (KRAS)    04916 Melanogenesis     120407327 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mrv04131]     120407327 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mrv04031]     120407327 (KRAS) Membrane trafficking [BR:mrv04131]  Endocytosis   Macropinocytosis    Ras GTPases     120407327 (KRAS) GTP-binding proteins [BR:mrv04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120407327 (KRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  120407327 NCBI-ProteinID:  XP_039398776 LinkDB All DBs Position LG1:240390391..240487625 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRVKKISKEEKTPGC VKIKKCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatacaaacttgtagttgttggagctggaggtgtaggcaagagtgccttgacg atacagctaattcagaatcattttgtggatgaatatgatcctacaatagaggattcctac aggaaacaagtagtaattgatggagaaacctgtctcttggatattcttgatacagcaggt caagaagagtacagtgcaatgagggaccaatacatgagaacaggggagggattcctatgt gtatttgccataaataatacaaagtcatttgaagatattcaccattatagggaacaaata aaaagagttaaagattctgaagatgtccccatggtgctagtaggaaacaaatgtgactta ccttccagaacagtagatacaaaacaagctcaggacttagcacgaagttatggaattcct ttcattgaaacatcagcaaaaacaagacagagagtggaggatgctttttatacattggtg cgagagattcgacagtacagagtgaaaaaaatcagcaaagaagaaaagactccagggtgc gtgaaaattaaaaaatgtcttgtaatgtaa

DBGET integrated database retrieval system