Micromonospora sagamiensis: GCM10017556_47970 Help Entry GCM10017556_47970 CDS       T06946                                  Symbol mbtH Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism msag  Micromonospora sagamiensis Pathway msag00261   Monobactam biosynthesis msag01100   Metabolic pathways msag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msag00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GCM10017556_47970 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:msag01008]     GCM10017556_47970 (mbtH) Polyketide biosynthesis proteins [BR:msag01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GCM10017556_47970 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCL17058 LinkDB All DBs Position 5454111..5454302 Genome browser AA seq 63 aa AA seqDB search MSDPRFLVVRNDEEQYSIWAADRELPAGWQDAGFAGTREECLAHIDTVWTDMRPRSVREA AAS NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgtccgacccccgattcctggtcgtgcgcaacgacgaggagcagtactcgatctgggcg gccgaccgggagctccccgccggctggcaggacgccggcttcgccggcacccgggaggag tgcctggcccacatcgacaccgtgtggacggacatgcggccccgttccgtccgggaggcc gcggcgtcatga

DBGET integrated database retrieval system