Micromonospora sagamiensis: GCM10017556_50290 Help Entry GCM10017556_50290 CDS       T06946                                  Symbol mbtH Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism msag  Micromonospora sagamiensis Pathway msag00261   Monobactam biosynthesis msag01100   Metabolic pathways msag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msag00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GCM10017556_50290 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:msag01008]     GCM10017556_50290 (mbtH) Polyketide biosynthesis proteins [BR:msag01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GCM10017556_50290 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCL17290 LinkDB All DBs Position 5868268..5868477 Genome browser AA seq 69 aa AA seqDB search MGEFEDRRRYQVVVNDEEQYSIWPDGSDIPTGWRPVGVSGDRAVCLAHIDEVWTDMRPRS LRDWLGTRD NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgggggaattcgaggaccgacgtcggtaccaggtcgtcgtcaacgacgaggagcagtac tcgatctggccggacgggtcggacattccgaccggctggcggccggtgggtgtcagcggt gaccgggccgtctgcctggcgcacatcgacgaggtctggaccgacatgcgcccgcgcagc ctgcgcgactggctgggcacccgcgactga

DBGET integrated database retrieval system