Micromonospora sagamiensis: GCM10017556_56500 Help Entry GCM10017556_56500 CDS       T06946                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism msag  Micromonospora sagamiensis Pathway msag00261   Monobactam biosynthesis msag01100   Metabolic pathways msag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msag00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GCM10017556_56500  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:msag01008]     GCM10017556_56500 Polyketide biosynthesis proteins [BR:msag01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GCM10017556_56500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCL17911 LinkDB All DBs Position 6580259..6580477 Genome browser AA seq 72 aa AA seqDB search MNPFDDENAPFKVLVNDEGQYSVWPAFAEVPAGWTVCLADSPRSECLAYVEANWVDMRPR SLVEAMRAGDAR NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtgaaccccttcgacgacgagaacgccccattcaaggttctggtgaacgacgagggtcag tactccgtctggccggcgttcgcggaggttcccgccgggtggacggtgtgcctggccgac tcgccccgcagcgagtgcctggcctacgtggaggcgaactgggtcgacatgcggccccgt agcctggtcgaggcgatgcgggcgggcgacgcgcggtga

DBGET integrated database retrieval system